SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003720714.1.18062 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003720714.1.18062
Domain Number - Region: 73-94
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0222
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 
Domain Number - Region: 2-8
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003720714.1.18062
Sequence length 474
Comment pre-mRNA-splicing factor SLU7 [Magnaporthe oryzae 70-15]; AA=GCF_000002495.2; RF=representative genome; TAX=242507; STAX=318829; NAME=Magnaporthe oryzae 70-15; strain=70-15; AL=Chromosome; RT=Major
Sequence
MPPPPPPPRRPALGAAGASKEENVYIPNFISKRPFYAVDEGENTDYLEHQRIQKKEKDTG
WYDRGKTLGPAATKYRKGACENCGAMTHKVKDCLSRPRAKGAKWTGRDIKADELVQDVRM
GWDAKRDRWNGYDAREYQAVVEDYNKMEELRKEMQAKAAAESGKAIEDGDHYAETSDMSK
HQPTSTRQLRLREDTAKYLLNLDLDSAKYDPKTRTIVDAGATNDKTAELYAEQGFLRQSG
DAAEFEKAQRYAWEAQEKGGDTSLHLQANPTAGSYMRKKLKEEEDAKREERERQLREKYG
GEETKVLPDAIRQMAVTESERYVEYDEIGLIKGGPKGVARSKYKEDIFHNNHTSVWGSWW
SDFKWGYACCHSFVKNSYCTGEEGKAAWEAAERQRTGSGLLEPAADAEVDGAREEERKAS
EAETAAAAKEKAKKRTAEQMIGDVTEAELDEYRRKRTNTDDPMAQLLGRDELVT
Download sequence
Identical sequences L7I421 L7J0N5 Q51LA6
148305.Q51LA6 XP_003720714.1.18062 MGG_02985T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]