SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003799695.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003799695.1.62490
Domain Number 1 Region: 32-157
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.06e-23
Family Antibiotic resistance proteins 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003799695.1.62490
Sequence length 160
Comment PREDICTED: glyoxalase domain-containing protein 5 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MLCLLSSSLLVRMWGRTSEKQSWRYNNHTPSPCVIHRLDHIVMTVKNIKDTTMFYSKILG
MEVTIFKEGRKALCFGDQKFNLHEVGNEFEPKAAHPVPGSLDICLITEVPLEKMIQHLKA
CDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNYISS
Download sequence
Identical sequences H0X9Z0
XP_003799695.1.62490 ENSOGAP00000012412 ENSOGAP00000012412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]