SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003812828.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003812828.1.60992
Domain Number 1 Region: 5-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.88e-52
Family Extradiol dioxygenases 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003812828.1.60992
Sequence length 371
Comment PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like protein [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MAAPALRLCHIAFHVPAGQPLARDLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGA
GSGEPLYGLDPRHAVPSATNLCFDVADAGAATRELAALGCSVPVPPVRVRDAQGAATYAV
VSSPAGILSLTLLERAGYRGPFLPGFRPVSSAPGPGWVSRVDHLTLACTPGSSPTLLRWF
HDCLGFCHLPLSPGEDPELGLEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTR
QDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAA
GHEPHLLARQGILLDGDKGKFLLQVFTKSLFTEDTFFLELIQRQGATGFGQGNIRALWQS
VQEQSARSQEA
Download sequence
Identical sequences H2PYX0
XP_003812828.1.60992 XP_524567.1.37143 ENSPTRP00000001158 ENSPTRP00000001158 9598.ENSPTRP00000001158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]