SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003972456.1.43653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003972456.1.43653
Domain Number 1 Region: 413-467,505-629
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000643
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 588-721
Classification Level Classification E-value
Superfamily EF-hand 0.000000221
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003972456.1.43653
Sequence length 902
Comment PREDICTED: polycystin-2 [Takifugu rubripes]; AA=GCF_000180615.1; RF=representative genome; TAX=31033; STAX=31033; NAME=Takifugu rubripes; AL=Chromosome; RT=Major
Sequence
MSSSRVRPQQSPAARMPHGLESGEGIEMENIRHQDLGLGGVIGTPSPPSRQAWSRDNPGF
EHEDGIMEADWPPASPGRRSASTASGSSCSSGLGSFTGGGGGGGTHAPRGGLYPTPTVDT
QQQESHQRRSCMKQILQKIRILWGTELMEDRDSSRERYLRNILREMITYIAFLVTICILT
YGMVSANMYYYTKVMSQLFLDTPLSPGDPATFRSLATMEEFWKFTEGPFLNGMYWEVWYN
NKSLPENQSLIYYENLLLGVPRLRQVKVRNESCSIHQDLKGEVLECYNLYTPSNEDTASF
GPKNGTAWVYASETEVNGSSYWGQVSKYGGGGYYQDLSRTKEESMTKLQLLREHLWLDRG
TRAVFLDFSVYNGNINLFCIVRLLVEFPATGGVLTSWQFQTVRLIRYMSSWDYFVGLCEV
AFSLFILYYIVEEVLEIRIHRLHYFRSLWNCLDVLIIVLSVIAIIMNITRTAMVGKLLKG
LLENHTAHPSFGSLAHLQVQFNNVAAIIVFFSWVKLFKFINLNKTMSQLTTTMSRCAKDL
VGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQASIFTQFRIILGDFEFSEIEEANPVLG
PIYFTTFVFFIFFILMNMFLAIINDTYSEVKADMSQQRSEMEMTDFIKKGCNKALMKLRL
KKTAVDDITDSLRQAGGKLNLDELRQDLKGKGHTDAEIQAIFAKYDQEGDQELTEHEHQQ
MRDDLEKEREDLELERNSLTRPISGRSFPRTQEDSEEDDDEDSGHSSRRRGSSSGGVSYE
EFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKVKRRDVLGRLLDGVMEDERLGRD
TDAHREQMERLVREELERWECDDMGSQVSHPQPATPVGPRPRPSSSMSTDGLDTVTNGSS
HV
Download sequence
Identical sequences H2TX05
XP_003972456.1.43653 XP_011611232.1.43653 ENSTRUP00000029214 ENSTRUP00000029214 31033.ENSTRUP00000029214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]