SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004008706.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004008706.1.66739
Domain Number 1 Region: 259-437
Classification Level Classification E-value
Superfamily ITPase-like 1.35e-30
Family YjjX-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004008706.1.66739
Sequence length 445
Comment PREDICTED: protein PRRC1 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MMEESGIETTPPGTPPPNPGGLASAALSSSPAPLAAASTFSSPSGSSVQSLPPQVFSTPQ
PSLPPVQPAAPLPFVPSSPVPSVPPLVTSLPPPVSPPTGAAFSHPPLSHFPPSTSAPNTL
LSAPPSGPPTSGFSVGSAYDITRGHAGRAPQTPLMPSFSAPPVTGILPTPITQQAGLTSV
AQGTGTTSAITFPEEQEDPRIGRSQDEASAGGLWGFIKGVAGNPMVKSVLDKTKHSVESM
ITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVIGEAGQSNIAPQPV
GYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLIVEDPVHGIHL
EAFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMS
RRQMIYSAAKAIAGMYKQRLPPRTV
Download sequence
Identical sequences W5Q8M1
ENSOARP00000019063 XP_004008706.1.66739 XP_011985537.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]