SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004026115.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004026115.1.27298
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000392
Family Growth factor receptor domain 0.0046
Further Details:      
 
Domain Number 2 Region: 227-272
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000575
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 98-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000732
Family Fibronectin type I module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004026115.1.27298
Sequence length 381
Comment PREDICTED: protein CYR61 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MSSRIARALALVVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQL
NEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQ
CTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWICDEDSIKDPMEDQDGLLG
KELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQCS
KTCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKGKKCSKTKKSPEPVRFTY
AGCLSVKKYRPKYCGSCVDGRCCTPQLTRTVKMRFRCEDGETFSKNVMMIQSCKCNYNCP
HANEAAFPFYRLFNDIHKFRD
Download sequence
Identical sequences G3QVP6
ENSGGOP00000006825 ENSGGOP00000006825 XP_004026115.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]