SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004027071.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004027071.1.27298
Domain Number 1 Region: 23-200
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.35e-58
Family MHC antigen-recognition domain 0.00000000707
Further Details:      
 
Domain Number 2 Region: 207-294
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-21
Family C1 set domains (antibody constant domain-like) 0.00000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004027071.1.27298
Sequence length 327
Comment PREDICTED: T-cell surface glycoprotein CD1a isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MLFLLLPLLAVLPGDGNADGLKEPLSFRVIWIESFYNHSWKQNLVSGWLSDLQTHTWDSN
SSTIVFLWPWSRGNFSNEEWKELETLFRIRIIRSFEGIRRYAHELQFEYPFEIQVTGGCE
LHSGKVSGSFLQLAYQGSDFVSFQNSSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLS
DTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRG
EQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVRHSSLEGQDIVLYWEHHSSV
GFIILAVIVPLLLLIGLALWFRKRCFC
Download sequence
Identical sequences G3S7N6
XP_004027071.1.27298 ENSGGOP00000024095 ENSGGOP00000024095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]