SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004027888.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004027888.1.27298
Domain Number 1 Region: 26-144
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-18
Family V set domains (antibody variable domain-like) 0.0047
Further Details:      
 
Domain Number 2 Region: 137-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000211
Family I set domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004027888.1.27298
Sequence length 319
Comment PREDICTED: cell surface A33 antigen [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDK
LLLTHTERVVIWQFSNKNYIYGELYKNRVSISSNAEQSDASITIDQLTMADNGTYECSVS
LMSDLEGTTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNI
LNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVALYVG
IAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNRAAYEEPPEQLRELPREREEEDD
YRQEEQRSTGRESPDHLDQ
Download sequence
Identical sequences G3SJ82
ENSGGOP00000004431 ENSGGOP00000028172 XP_004027888.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]