SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004032918.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004032918.1.27298
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-22
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004032918.1.27298
Sequence length 300
Comment PREDICTED: pleckstrin homology domain-containing family A member 3 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTR
MELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSEL
RLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAK
FKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRR
RTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS
Download sequence
Identical sequences G1R2P1 G3RTW6 H2QJ23 Q9HB20
ENSPTRP00000021689 9598.ENSPTRP00000021689 9606.ENSP00000234453 ENSNLEP00000007463 ENSP00000234453 ENSNLEP00000007463 gi|54792084|ref|NP_061964.3| ENSGGOP00000019243 NP_061964.3.87134 NP_061964.3.92137 XP_003253832.1.23891 XP_003815558.1.60992 XP_004032918.1.27298 XP_515943.2.37143 ENSPTRP00000021689 ENSP00000234453 ENSP00000234453 ENSGGOP00000012663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]