SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004034330.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004034330.1.27298
Domain Number 1 Region: 30-525
Classification Level Classification E-value
Superfamily Sema domain 8.76e-160
Family Sema domain 0.000000000193
Further Details:      
 
Domain Number 2 Region: 521-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000012
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 590-673
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000014
Family V set domains (antibody variable domain-like) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004034330.1.27298
Sequence length 782
Comment PREDICTED: semaphorin-3G isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MAPSAWAICWLLGGLLLHGGSSGPSPGPSVPRLRLSYRDLLSANRSAIFLGPQGSLNLQA
MYLDEYRDRLFLGGLDALYSLRLDQAWPDPREVLWPPQPGQREECVRKGRDPLTECANFV
RVLQPHNRTHLLACGTGAFQPTCALITVGHRGEHVLQLEPGSVESGRGRCPHEPSRPFAS
TFIDGELYTGLTADFLGREAMIFRSGGPRPALRSDSDQSLLHDPRFVMATRIPENSDQDN
DKVYFFFSETVPSPDGGSNHVTVSRVGRVCVNDAGGQRVLVNKWSTFLKARLVCSVPGPG
GAETHFDQLEDVFLLWPKAGKSLEVYALFSTVSAVFQGFAVCVYHMADIWEVFNGPFAHR
DGPQHQWGPYGGKVPFPRPGVCPSKMTTQPGRPFGSTKDYPDEVLQFARAHPLMFWPVRP
RHGRPVLVKTHLAQQLHQIVVDRVEAEDGTYDVIFLGTDSGSVLKVIALQAGGSAEPEEV
VLEELQVFKVPTPITEMEISVKRQMLYVGSRLGVAQLRLHQCETYGTACAECCLARDPYC
AWDGASCTHYRPSLGKRRFRRQDIRHGNPALQCLGQSQEEEAVGLVAATMVYGTEHNSTF
LECLPKSPQAAVRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLSRFDAGTYTCTTLEH
GFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLASTPPKAWYKDILQLIGFANLP
RVDEYCERVWCRGTTECSGCFRSRSRGKQARGKSWAGLELGKKMKSRVHAEHNRTPREVE
AT
Download sequence
Identical sequences G3RIL7
XP_004034330.1.27298 ENSGGOP00000015526 ENSGGOP00000015526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]