SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004042941.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004042941.1.27298
Domain Number 1 Region: 25-113
Classification Level Classification E-value
Superfamily Immunoglobulin 4.39e-18
Family V set domains (antibody variable domain-like) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004042941.1.27298
Sequence length 301
Comment PREDICTED: hepatitis A virus cellular receptor 2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MFSHLPFDCVLLLLLLLLTRSSEVEYRVEVGQNAYLPCFYTPAAPGNLVPVCWGKGVCPV
FECGNVVLRTDERDVNYRKSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMND
EKFNLKLVIKPAKVTPAPTLQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA
NELRDSGLANELWDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI
SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSGQQPSQPFGCRFAI
P
Download sequence
Identical sequences G3SHL5
ENSGGOP00000020592 ENSGGOP00000027604 XP_004042941.1.27298 XP_018883770.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]