SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004043784.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004043784.1.27298
Domain Number 1 Region: 271-340
Classification Level Classification E-value
Superfamily Immunoglobulin 1.51e-16
Family I set domains 0.029
Further Details:      
 
Domain Number 2 Region: 53-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000022
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 174-241
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000039
Family C2 set domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004043784.1.27298
Sequence length 435
Comment PREDICTED: advanced glycosylation end product-specific receptor isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGAGERVQAPPRVEATAGRGADRARTLEGSRMAAGTAVGAWVLVLSLWGAVVGAQNITAR
IGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAV
GIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGS
YPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPHPTFSCS
FSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQI
HWMKDGVPLPLPPSPMLILPEIGPQDQGTYSCVATHPSHGPQESRAVSISIIEPGEEGPT
AGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRQGEERKAAENQEEEEECAELN
QSEEPQAGESSTGGP
Download sequence
Identical sequences XP_004043784.1.27298 ENSGGOP00000002285 ENSGGOP00000002285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]