SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004043821.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004043821.1.27298
Domain Number 1 Region: 11-125
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.92e-42
Family MHC antigen-recognition domain 0.00000391
Further Details:      
 
Domain Number 2 Region: 125-221
Classification Level Classification E-value
Superfamily Immunoglobulin 2.48e-29
Family C1 set domains (antibody constant domain-like) 0.00000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004043821.1.27298
Sequence length 261
Comment PREDICTED: HLA class II histocompatibility antigen, DQ beta 1 chain isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MSWKKALQIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVVQFKAMCYFTNGTERVRYVT
RYIYNREESARFDSDVGVYRAVTPQGRPDAEYWNSHKDILESTRAELDTVCRNNYEVAFR
GILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLI
RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVL
GLIFLGLGLIIRQRSQKGLLH
Download sequence
Identical sequences G3RPG3
XP_004043821.1.27298 ENSGGOP00000017683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]