SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004044033.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004044033.1.27298
Domain Number 1 Region: 89-182
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000303
Family V set domains (antibody variable domain-like) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004044033.1.27298
Sequence length 380
Comment PREDICTED: trem-like transcript 2 protein [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MNPCGWLGAVGPTLPHFPKWAASLLEPQVLPWQAQVAHPVSGGPSPWISRPDTAQLDGTM
APAFLLLLLLWPQGCVSGPSADSVYTKVRLLEGGTLSVQCSYKGYKNRVEGKVWCKIRKK
KCEPGFARVWVKGPRYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMGFQL
DVSPAPQTERNIPFTHLANILKSGTVTTGQAPTSGPDAPFTTGVMVFTPGLITLPRLLAS
TRPASKTGYSFTATSTTSQGPRRTTGSQTVTASPSNARDSSAGPESISTKSGDLSTRSPT
TGLCLTSRSLLNRLPSMPSIRHQDVYSTVLGVVLTLLVLMPIVVYGFWKKRHMASYSMCS
NPSRRDPPGRPEPYVEVYLI
Download sequence
Identical sequences ENSGGOP00000009225 XP_004044033.1.27298 ENSGGOP00000009225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]