SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004045292.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004045292.1.27298
Domain Number 1 Region: 11-134
Classification Level Classification E-value
Superfamily FKBP-like 1e-33
Family FKBP immunophilin/proline isomerase 0.00019
Further Details:      
 
Domain Number 2 Region: 112-205
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000391
Family Calbindin D9K 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004045292.1.27298
Sequence length 211
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP14 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHH
DALVEDIFDKEDEDKDGFISAREFTYKHDEL
Download sequence
Identical sequences A0A090N7V8 G3RF27 H2QUC7 Q5R941 Q9NWM8
9598.ENSPTRP00000032523 9606.ENSP00000222803 ENSGGOP00000014183 gi|8923659|ref|NP_060416.1| ENSP00000222803 ENSP00000222803 ENSP00000222803 ENSGGOP00000014183 ENSPTRP00000032523 NP_060416.1.87134 NP_060416.1.92137 XP_004045292.1.27298 XP_519022.2.37143 ENSPTRP00000032523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]