SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004057037.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004057037.1.27298
Domain Number 1 Region: 99-309
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.52e-60
Family Endonuclease III 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004057037.1.27298
Sequence length 312
Comment PREDICTED: endonuclease III-like protein 1 isoform X4 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MCSPQESGMTALSARMLTRSRSLGPGARPRGCREEPGPLRRREAAAEARKSHSPVKRPRK
AQRLHVAYEGSDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYD
SSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVG
FWRSKVKYIKQTSAILQQRYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDT
HVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVRPRCHAC
LNQALCPAAQGL
Download sequence
Identical sequences G3SGX3
ENSGGOP00000027360 XP_004057037.1.27298 ENSGGOP00000027360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]