SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004057086.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004057086.1.27298
Domain Number 1 Region: 17-131
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-28
Family Kringle modules 0.00085
Further Details:      
 
Domain Number 2 Region: 218-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-20
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004057086.1.27298
Sequence length 462
Comment PREDICTED: kremen protein 2 isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPC
LFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCH
MPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDL
ARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYG
PDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLG
TAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPRA
PPAAIGARVFSTVTAVSVLLLLLLGLLRPLRRRSCLLAPGKGPPALGPSRGPRRSWAVWY
RQPRGVALPCSPGDPQAEGSAAGYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences G3QQZ6
ENSGGOP00000019280 ENSGGOP00000005026 XP_004057086.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]