SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004059410.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004059410.1.27298
Domain Number 1 Region: 46-168
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000627
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 
Domain Number 2 Region: 186-252
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000054
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004059410.1.27298
Sequence length 328
Comment PREDICTED: sialic acid-binding Ig-like lectin 15 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MEKSIQLLACLACVLSTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAA
VLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNP
RRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPGLA
HAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPGEGHGHLVTAELPALTHDGRYTCTAA
NSLGRSEASVYLFRFHGASGASTVALLLGALGLKALLLLGVLAARAARRRPEHLDTPDTP
PRSQAQESNYENLSQMNPRSPPATMCSP
Download sequence
Identical sequences G3QXS6
ENSGGOP00000007636 ENSGGOP00000007636 XP_004059410.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]