SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004060555.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004060555.1.27298
Domain Number 1 Region: 91-137,176-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000447
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004060555.1.27298
Sequence length 650
Comment PREDICTED: lipolysis-stimulated lipoprotein receptor isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGL
GSHPAAPGRDAVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPT
QPIVIWKYKSFCRDRIADAFSPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQ
GNAVTLGDYYQGRRITITGNADLTFDQTAWGDSGVYYCSVVSAQDLQGNNEAYAELIVLG
RTSGVAELLPGFQAGPMEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPD
KCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDV
DRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRP
GPPNGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQA
GGGWRARRPRARSVDALDDLTPPSTAESGSRSPTSSGGRRSRAYMPPRSRSRDDLYDQDD
SRDFPRSRDPHYDDFRSRERPPADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKG
SEERRRPHKEEEEEAYYPPAPPPYSETDSQASRERRLKKNLALSRESLVV
Download sequence
Identical sequences G3RQZ9
ENSGGOP00000000755 XP_004060555.1.27298 ENSGGOP00000000755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]