SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004063198.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004063198.1.27298
Domain Number 1 Region: 19-119
Classification Level Classification E-value
Superfamily Immunoglobulin 6.77e-26
Family V set domains (antibody variable domain-like) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004063198.1.27298
Sequence length 123
Comment PREDICTED: pre-B lymphocyte protein 3 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MACRCLSFLLMGTFLSVSQTVLAQPDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQR
AGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYG
FSP
Download sequence
Identical sequences G3SDJ0
XP_004063198.1.27298 ENSGGOP00000026170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]