SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004064756.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004064756.1.27298
Domain Number 1 Region: 114-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000303
Family VWC domain 0.039
Further Details:      
 
Domain Number 2 Region: 258-325
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000471
Family VWC domain 0.0087
Further Details:      
 
Domain Number 3 Region: 35-102
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000251
Family VWC domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004064756.1.27298
Sequence length 458
Comment PREDICTED: chordin-like protein 1 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MRKKWKMGGMKYIFSLLFFLLLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEPYGLV
YCVNCICSENGNVLCSRVRCPNVHCVSPVHIPHLCCPRCPEDSLPPVNNKVTSKSCEYNG
TTYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCR
GDGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPSRQAGGLSRFPGARSHRGALMDSQ
QASGTIVQIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKK
IHCPNRYPCKYPQKIDGKCCKVCPGKKAKEELPGQSFDNKGYFCGEETMPVYESVFVEDG
ETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKI
FTEGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC
Download sequence
Identical sequences G3QJ73
ENSGGOP00000002456 XP_004064756.1.27298 XP_018875333.1.27298 ENSGGOP00000002456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]