SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004067089.1.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004067089.1.28442
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-30
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 9-64
Classification Level Classification E-value
Superfamily L27 domain 3.73e-26
Family L27 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004067089.1.28442
Sequence length 201
Comment protein lin-7 homolog C isoform X1 [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MASLGEPVRLERDINRAIELLDKLQRTGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGTVKLVVRYTPKVLEE
MESRFEKMRSARRRQQNNYPQ
Download sequence
Identical sequences H2LN04
ENSORLP00000007427 8090.ENSORLP00000007427 XP_004067089.1.28442 ENSORLP00000007427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]