SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004084072.2.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004084072.2.28442
Domain Number 1 Region: 637-892
Classification Level Classification E-value
Superfamily YWTD domain 8.89e-55
Family YWTD domain 0.00000383
Further Details:      
 
Domain Number 2 Region: 24-284
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-52
Family YWTD domain 0.00000179
Further Details:      
 
Domain Number 3 Region: 336-574
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-52
Family YWTD domain 0.0000029
Further Details:      
 
Domain Number 4 Region: 940-1201
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-41
Family YWTD domain 0.0000414
Further Details:      
 
Domain Number 5 Region: 1330-1368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 895-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000241
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1251-1291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 1292-1328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 593-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000393
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 10 Region: 290-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000512
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 11 Region: 1209-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004084072.2.28442
Sequence length 1623
Comment low-density lipoprotein receptor-related protein 6 [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MGVALRSLLLLFSFSFVVRVAGEPLLLYANRRDLRLVDTAHEKANDTVVVGGLEDAAAVD
YVYSQGLIYWSDVSEEAIKRTFFNQSGASPVQTVVQGLASPDGLACDWLGSKLYWTDSET
NRIEVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEVPKIERAGMDGTNRSMI
IHKDIYWPNGLTLDYSQQKLYWADAKFNFIHRSNLDGSHREVVVKDELPHPFALTLYEST
LFWTDWNTHSIHSCTKETGRGQRTVHSNIFSPMDIHVFSPRRQPVSVNSPCSRDNGGCSH
LCLLAPSSPFFRCACPTGVQLLEDGRTCRDGATQMLLLARRTDLRQISLDTPDFTDVVLQ
VEDIRHAIAIDYDPVEGYLYWTDDDVKAIRRSRLDGSDAQFIVTSQVSHPDGIAVDWIAR
NLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERAD
LDGMERVVMVNTSLGWPNGLALDYHEGRMYWGDAKTDKIEVMNVNGTGRRVLVENKLPHI
FGFTLLGDHIYWTDWQRRSIERVHKRTAEREVIIDQLPDLMGLKATFVHEAFGSNPCAES
NGGCSHLCLYKPRGVQCGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNNNVA
IPLTGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWL
GKNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDR
AAMDGTGRITLVGNVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGLDREVIADDLPHP
FGLTQYQDYIYWTDWSQRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQGGWNACAA
TNGHCSHLCLAVPVSSFVCGCPAHFSLNEDNKTCSAPTSFLLFSQKSAINRMVIDEQQSP
DIILPIHNLKNVRAIDYDPLDKHLYWIDSKQNLIRRAQENGNQCTTVVSSSLIGPGQVLQ
LYDLSIDIFSRFIYWTNEATNVINVTRMDGSRVGVVLNGEQDRPRAIVVNPERGYMYFTN
LQDRSPKIERAALDGTEREVLFFGGLGKPVALAIDNDVGKLFWVDSDLRRIESSDLSGAN
RIVIADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKMTRDGRTKVQARVSYLSDIHAVH
ELDMRDYGKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPDQFA
CTSGEVDCIPQTWRCDGYSECDDSSDEEDCPVCSEDEFQCDSRQCIDLSLRCNGEVNCQD
RSDENKCEVPIRCPADQFSCSNGQCIGKHKKCDHNMDCSDNSDEIGCYPTEEPPPPTNST
INSIVGVVMALFVVGAIYFVCQRVLCPQMKDDGETVTTNDFVVHGPSSVPLGYVPHPSSL
SSSLPGMTRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPA
TVRSQYTLEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPLKSS
GAAKGYTSDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPFTERSYSHHLYPPPPSPCT
DSS
Download sequence
Identical sequences XP_004084072.2.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]