SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004174725.1.42559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004174725.1.42559
Domain Number 1 Region: 137-259
Classification Level Classification E-value
Superfamily FKBP-like 1.77e-39
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 2 Region: 31-141
Classification Level Classification E-value
Superfamily FKBP-like 5.11e-35
Family FKBP immunophilin/proline isomerase 0.0002
Further Details:      
 
Domain Number 3 Region: 248-321
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000000687
Family FKBP immunophilin/proline isomerase 0.0051
Further Details:      
 
Domain Number 4 Region: 339-403
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000109
Family Calmodulin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004174725.1.42559
Sequence length 417
Comment PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase FKBP10 [Taeniopygia guttata]; AA=GCF_000151805.1; RF=representative genome; TAX=59729; STAX=59729; NAME=Taeniopygia guttata; AL=Chromosome; RT=Major
Sequence
MAALAPAQTQSFVAGWTRPGAPGAGRPRPLEDVVIDRYYIPKICLREAQMGDFIRYHYNG
TFKDGKKFDSSYDRGATVAGVVGVGRLITGMDRGLQGMCVNERRHLIVPPHLGYGSIGVA
GLIPPDATLYFDVVMLDIWNKNDKLQITTLSKPERCNRTVENSDFVRYHYNGTLLDGTPF
DSSYSKGSTYDTYVGTGWLIKGMDQGLLGMCAGEKRSIIIPPFLAYGEKGYGTVIPPQAS
LVFSVLLVDFHNPKDGVFLEHLEVPESCTRRAVTGDFVRYHYNGTLMDGTLFDSRCGRRW
PSRGVPGSAVLRFEVELISMEEGVPEGYLFIWHGDPPANLYEQMDLNKDGGIPAEEFSTF
IKTQVAEGKGRLMPSSDPEKVIADMFRNQDRNQDGKITPDELKLKSDEDQEKIHEEL
Download sequence
Identical sequences XP_004174725.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]