SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004239648.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004239648.1.44838
Domain Number 1 Region: 13-142,405-525
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 3.4e-86
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00015
Further Details:      
 
Domain Number 2 Region: 210-378
Classification Level Classification E-value
Superfamily GroEL apical domain-like 7.06e-49
Family Group II chaperonin (CCT, TRIC), apical domain 0.0000004
Further Details:      
 
Domain Number 3 Region: 142-214,369-403
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 2.69e-25
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004239648.1.44838
Sequence length 557
Comment PREDICTED: T-complex protein 1 subunit gamma [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MHAPVLVMQDSMKREQGGKVQRANIQAAKAVADIIRTTLGPRSMLKMLLDAAGGIVVTND
GNAILRELDLAHPAAKSMIELSRTQDEEVGDGTTSVIVLAGEMLHVAEAFIDKKYHPTVI
CRAYAKALEDAVAVLDKIAMTVDVEDRETMLGLVKSCIGTKFTSQFGDLISDLAIDATRM
VGVELGQGLREVDIKKYIKIEKVPGGQLEDSVVLKGVMMNKDVVAPGKMKRKIVNPRIIL
LDCPLEYKKGENQTNAELLREEDWTVLLKMEEEYIENMCAQILKFKPDVVITEKGLSDLA
CHYLCKAGVSAIRRLRKTDNNRIAKACGAVIVNRPDELQESDVGTGAGLFEVKKIGDEFF
TFIVDCKDPKACTILLRGASKDLLNEVERNLQDAMSVARNIIKCPKLVPGGGATELTVSA
MLKQKSSSVEGIEKWPYEAAAIAFEAIPRTLAQNCGVNVIRTMTALQGKHANGENAWIGI
DGNTGEITDMKERKIWDSYAVKAQAFKTAIEAACLLLRIDDIVSGIKKKQAPGAGQGPSK
PKIDEEGDADNDQLIPE
Download sequence
Identical sequences K4C2V5
Solyc05g056310.2.1 Sopim05g056310.0.1 Solyc05g056310.2.1 XP_004239648.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]