SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004246657.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004246657.1.44838
Domain Number 1 Region: 116-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-29
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004246657.1.44838
Sequence length 694
Comment PREDICTED: auxin response factor 18-like isoform X1 [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MITFMDPKEKVKEVEKCLDSQLWHACAGSMVQMPSISSKVFYFPQGHSEHASGNVDFRSS
IRIPSYIPCKVSAIKYMADPETDEVFAKIRLIPVGRNEVEFDDDGVVGMNGSDNQDKPSS
FAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQTILAKDVHGETWKFRHIYRGT
PRRHLLTTGWSTFVNHKKLVAGDSIVFLRAENGDLCVGIRRAKRGIGGGPETSSGWNPAG
GNCMVPYGGFSSFLREDENKLMRNGNGNNGGNLMNKGKVKAESVIEAANLAASGQPFEVI
YYPRASTPEFCVKSSLVKSALQIRWCSGMRFKMPFETEDSSRISWFMGTISSVQVSDPIR
WPDSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPTIHLSPFSPPRKKLRLPQHPDFP
LDGHLPMPAFSGNHLLGPNSPFGCLPDNTPAGMQGARHAQYGLSLSDLHFNKLHSSLFPV
GFPPLDQAAAAPRRPLNSPMISKPCNNENISCLLTMGNSAHSTKKSDIGKAPQLVLFGQP
ILTEQQISLSCSGDTVSTVRTGNSSSDGNADKIGNVSDGSGSALNQRGLTERSPCDTFQS
DPNTEIGHCKVFMESEDVGRTLDLSLLGSYEELCRKLANMFGIDNSEMLNHVLYRDTTGS
VKQLGDEPFSDFMKTARRLTILTDSSSDNVGIRE
Download sequence
Identical sequences K4CQH0
Solyc09g007810.2.1 Solyc09g007810.2.1 XP_004246657.1.44838 Sopim09g007810.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]