SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004254578.1.21224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004254578.1.21224
Domain Number - Region: 7-81
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0068
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 154-261
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004254578.1.21224
Sequence length 318
Comment M protein, serotype 24 precursor, putative [Entamoeba invadens IP1]; AA=GCF_000330505.1; RF=representative genome; TAX=370355; STAX=33085; NAME=Entamoeba invadens IP1; strain=IP1; AL=Scaffold; RT=Major
Sequence
MAEQQANVEQIANLETAKAALNAEIAQLQQTKANITGEIDGLNKTKEATTSEINTLQTNK
CAIEEQISNAKKELLEVEEEIKKKKTPDEREANIIEQENHYLELNTMFEQLVKQNEENKT
IFEAKQTELQKSLDESKILKEHLDSENNKLDVTMKQTETLKKEYEIKIQDAKDAIASYEK
QRKIYEDQNKLIIAAQNVLQMQIKREKEKYTENQKLIENSKIIYQKFEQQNEQLNNLLDK
TKEERELLSKQKDEFEKNNEEVFKKRLDNVKKEDDLNRREKTIKCAELKIEKIPDVVEEI
KVEKVEKKEDVPPPQQPQ
Download sequence
Identical sequences A0A0A1U1C3 S0B4M5
jCVI|EIN_160220 XP_004254578.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]