SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004258343.1.21224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004258343.1.21224
Domain Number 1 Region: 488-608
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000255
Family Synaptotagmin-like (S variant) 0.042
Further Details:      
 
Weak hits

Sequence:  XP_004258343.1.21224
Domain Number - Region: 249-360
Classification Level Classification E-value
Superfamily E set domains 0.07
Family Arrestin/Vps26-like 0.037
Further Details:      
 
Domain Number - Region: 15-182
Classification Level Classification E-value
Superfamily E set domains 0.077
Family Arrestin/Vps26-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004258343.1.21224
Sequence length 669
Comment hypothetical protein EIN_129120 [Entamoeba invadens IP1]; AA=GCF_000330505.1; RF=representative genome; TAX=370355; STAX=33085; NAME=Entamoeba invadens IP1; strain=IP1; AL=Scaffold; RT=Major
Sequence
MEVQVDTVIERGCVIGEPIVGYIRLTLQKPFNITTAYVSLCLHVPNYAIAQHPSLPSNQK
FLPLKKIQTITFSFGIFTCLGFPNMTSHEYPPGIFKLPFTFNLPQNFQPTLIVPDLFIVA
SYSLQGFVISAAQPFTGPQVPLHLLQTKLIQLQDNVLQHPKLLQQQQQQQFMSNELPKID
PDDFSQDLELPSVPMTVGTDFTNAMKMEDKHLSIKPEVTPTVTPRPNRQEMDNLIENPPK
MLGASLCSFTTSKEMYAQGEVINAKISVRSLKSLTPTLTIGLYGFLIHETVIASKCYTKL
TLQESSEDYTQNLQIEIPPIVPPTFTSLFLRWEYFIIISIPPQKVQSSSIYVPVTIKAPF
VSLDTLALYSTSLGVKTPNEPFSIHDKIPFFINEENGIERGKSVDGKTVVLNHVERTAGF
EQDFEENTQTILYPCYTSITLPPGFSFGRYQNRATVIDHINGIVYWKFQFQNQRVPQSMV
SGLRDIPVLQITVLDTFGLNVISKGMIPSYFCQVRGDDGNWIKSVVVKGIDPELNFEFNL
RPSVTRQNVVLYFYTKKKFGGKKYIGFIDIDLCETPFNTFVEKLYPIQKSDFGNEPFLGF
VRLRIDYNKEETTQSPPKIIRTVFTPTVDVSPNRTPETLHQIQKQNLLRTKFGKNKIYDV
LGDTIKINL
Download sequence
Identical sequences L7FMJ0
jCVI|EIN_080380 XP_004258343.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]