SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004276622.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004276622.1.21590
Domain Number 1 Region: 204-321
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.62e-24
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 102-210
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 5.23e-21
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 49-100
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000632
Family TS-N domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004276622.1.21590
Sequence length 328
Comment PREDICTED: elongation factor Ts, mitochondrial isoform X2 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MSLLRSLRSLRLCLVARAGSCPVGPLLLQSPQPWHTFHAGPWLSSSASSKELLMKLRRRT
GYSFVNCKKALETCGGDLKQAESWLHKQAQKEGWSKAARLHGRKTKEGLIGLLQEGNTTV
LVEVNCETDFVSRNLKFQQLVQQVALGTLLHCQSLKDQLSTYSKGFLNSSELSELPAGRE
REGCLRDQLALAIGKLGENMILKRAAWVKVPAGFYVGSYVHGAMHSPSLHNLVLGKYGAL
VICETSEQKANLEDLGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLG
QYVQPQGVSVVDFVRFECGEGKEAAEAE
Download sequence
Identical sequences ENSTTRP00000007911 ENSTTRP00000007911 XP_004276622.1.21590 XP_004317891.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]