SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004278086.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004278086.1.21590
Domain Number 1 Region: 642-897
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 30-290
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-54
Family YWTD domain 0.0000017
Further Details:      
 
Domain Number 3 Region: 341-571
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-51
Family YWTD domain 0.0000027
Further Details:      
 
Domain Number 4 Region: 944-1203
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-38
Family YWTD domain 0.0000709
Further Details:      
 
Domain Number 5 Region: 1332-1372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1294-1329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1254-1292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 900-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family EGF-type module 0.03
Further Details:      
 
Domain Number 9 Region: 597-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000345
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 10 Region: 295-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1211-1263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000186
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004278086.1.21590
Sequence length 1612
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MEAAPPRPRPPPLLLLLALCCSLAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVSGLE
DAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLY
WTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGEIPRIERAGMDG
STRKVIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFAL
TLSGDTLYWTDWQTRSIHACNKRTGDKRKEILSALYSPMDIQVLSPERQPYYHTQCEENN
GGCSHLCLLSPREPFYACACPTGVQLQDNGQTCKAGAEEVLLLARRTDLRRISLDTPDFT
DIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAV
DWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPK
IECANLDGQERRVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINIDGTKRRTLLED
KLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKAVGTN
PCADRNGGCSHLCFFTPRAAKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLDTN
NNDVAIPLTGVKEASALDFDVSNHHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGM
AVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGK
PRIVRAFMDGTNCVTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIAD
DLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGL
NDCMHNNGQCGQLCLAVPSGRRCSCASHYTLDPSSRNCSPPTTFLLFSQKCAISRMIPDD
QHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPSQSQNPD
RQPHDLSVDVYSRTLFWTCEATDTINVHRLNGEAMGVVLRGDRDKPRAIVVNAERGYLYF
TNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSG
ANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVDKTTGDARTRVQGRVAHLTGIHA
VEDISLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQ
FACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADC
QDRSDEADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCVDGSDELMCEITKLPSDDGPAH
SSAIGPVIGIILSLFIMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGS
QHGPFTGISCSKSMMSSVSLMGGRAGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPS
PATDPSLYNVDMFYPSSIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYY
LDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences XP_004278086.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]