SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004409425.1.74151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004409425.1.74151
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.44e-92
Family Calponin-homology domain, CH-domain 0.00000325
Further Details:      
 
Domain Number 2 Region: 2172-2289
Classification Level Classification E-value
Superfamily PH domain-like 1.53e-33
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-33
Family Spectrin repeat 0.0000813
Further Details:      
 
Domain Number 4 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-29
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 5.4e-29
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 1009-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-27
Family Spectrin repeat 0.00000461
Further Details:      
 
Domain Number 7 Region: 1532-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-27
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 8 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-27
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 9 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-25
Family Spectrin repeat 0.00057
Further Details:      
 
Domain Number 10 Region: 815-949
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-25
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 8e-20
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 13 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-19
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 14 Region: 1350-1447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000128
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 15 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004409425.1.74151
Sequence length 2326
Comment PREDICTED: spectrin beta chain, erythrocytic [Odobenus rosmarus divergens]; AA=GCF_000321225.1; RF=representative genome; TAX=9708; STAX=9707; NAME=Odobenus rosmarus divergens; AL=Scaffold; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWAAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSNLARVPCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPQVNVTNFTSSWKDGLAFNALIHRHRPDLIDFDKLKDSNARHNLEHAFKV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASELLTWIEQTVTVLNSRRFANSLAGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRNELIRQEKL
EQVARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKA
LEDLAQELEQENYHDQKRITARKDNILRLWSYLQELLRSRRQRLEMTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLVEADIAIQGDKVKAITAATLQFTEEKGY
QPCDPQVIQDRVSHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDTHLEQIFQEAEGMVARKQFGHPQIEARIKE
VSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLAELEESRGVMEHLEQQAQGFPQEFRDSPDVTNRLQALRELYQQVVAQADLR
RQRLQDALDLYTVFGETDACELWMGEKEKWLAQMEIPDTLEDLEVAQHRFDILDQEMKTL
MTQIDGVNLAANSLVDSGHPRSGEVKQYQDHLNDRWQAFQTIVSDRREAVNSALRVRNYC
VDCEETSKWIEDKMQVVQTTKELGQDLAGIIAIQRKLSGLERDVAAIRDRVGALERESQQ
LMASHPEQGEDIGQRQACVEKLWQELQEALLEQEASLGEASQLQAFLQNLDDFQAWLSMA
QKAVASEDMPESLPEAEQLLQQHVAIKDDIDRHQEIFQNVKVSGENVIRDQTDPEYLLLG
QRLEGLDAGWDALCRMWESRNHSLAQCLGFREFQRDAKQAEAILSNQEYTLAHLEPPDSL
EAAEVGIRKFEDFLVSVENNQDKVLSPVDSGNKLIAEENLYSDKILEKVQLIEDRHRKNK
EKAEETSIILKDNLELQHFLQNCQELTLWINDKLLTSQDVSYDDARNLQNKWAKHQAFMA
DLASHQGWLDSIDAEGKQLMEEKTQYRALVSQRLEDLHRLWDELQATTQERAQHLSAARS
SYLRSQTHADLNKWIGAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELLA
QVPSLGEEAGDTDMSIERRFLDLLEPLERRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSADYGTNLQTVQLLMKKNQTLQNEILGHAPWVEDVLQRGQRLVEAAEIDCQDMEERLG
HLQGSWDTLQEAAAGRLQRLQDASEAQQYYLDAGEAEAWISEQELYIISDETPKDEEGAI
VMLKRHLRQQHALEEYGRNIKQLAARAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDIAE
ERRRKLENMFHLFQLKREADDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNVIIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGTEILGLIDEKLRELPEDVGLDASTAESFHRVHTAFERELDLLSVQVQQFQDVAG
RLQKAYAGEKAETIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWME
GIIRQIETQEKPRDVSSVELLMKYHQGIKAEIDTRSKNFSACLELGESLLERQHQASEEI
REKLKQVLSRRKEMAEKWEDRQEQLRMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDGVEKLIKRHEAFEKSTATWAERFAALEKPTTLELKERQTPERPEEESGPQEEEGETAG
EAPRGPHRAATERTSPGEEESQWPQDLQPPPPPGPQEKSSGDERPATEPLFKVLDTPLSE
GDEPTTLPAQQDHGYSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFYKDAK
NLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLSWLQG
VSTAINESQSIRVKAQSLPLPSSTGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_004409425.1.74151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]