SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004470934.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004470934.1.11602
Domain Number 1 Region: 43-513
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.23e-133
Family Pyridoxal-dependent decarboxylase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004470934.1.11602
Sequence length 519
Comment PREDICTED: acidic amino acid decarboxylase GADL1 isoform X1 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MSRRSDRERPPHGDQQEMVPSKKNAVLVDGVVLNGPTTNVKAGEKFVEEACRLILDEVVL
KATDVNEKVCEWQPPEQLKQLLDLEMRDTGEPHPRLLELCQDIIRYSVKTNHPRFFNQLY
AGLDYYSLVARFMTEALNPSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGDGIFNPGGSV
SNMYAMNLARYKYCPDIKEKGLSGLPRLVLFTSAECHYSMKKAASFLGIGTENVCFVETD
GRGKMIPEELEKQVCQARKEGAVPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHVDA
SWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDTSDLLKKCYSAKAS
YLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLVEE
IKKREGFKLLMEPEYANICFWYIPPSLRDMEEGPEFWEKLNSVAPVIKERMMKKGSLMLG
YQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGRDM
Download sequence
Identical sequences XP_004470934.1.11602 ENSDNOP00000028689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]