SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004564919.1.88231 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004564919.1.88231
Domain Number 1 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 1.22e-54
Family YWTD domain 0.00000425
Further Details:      
 
Domain Number 2 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-51
Family YWTD domain 0.00000181
Further Details:      
 
Domain Number 3 Region: 333-566
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-50
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 4 Region: 937-1198
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-39
Family YWTD domain 0.000038
Further Details:      
 
Domain Number 5 Region: 1327-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1248-1288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 7 Region: 892-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000486
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1289-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 590-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000393
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 10 Region: 287-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000122
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 1206-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004564919.1.88231
Sequence length 1617
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X3 [Maylandia zebra]; AA=GCF_000238955.2; RF=representative genome; TAX=106582; STAX=106582; NAME=Maylandia zebra; ecotype=Mazinzi reef; AL=Scaffold; RT=Major
Sequence
MGVALRSLLLCSFCFLIRGEPLLLYANRRDLRLVDAAHEKANSTVVVGGLEDAAAVDYVF
SKGLIYWSDVSEEAIKRTFFNQSGASALETVVSGLASPDGLACDWLGSKLYWTDSETNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEIPKIERAGMDGTNRSMIIDK
EIYWPNGLTLDYSQQKLYWADAKHSFIHRSNLDGSFREVVVKGELPHPFALTLFEDTLFW
TDWTTHSIHSCRKQTGGGQRVVHSNIFSPMDIHVFSTKRQPTAVNTPCSLNNGGCSHLCL
LSPVRPFYRCACPTGVQLLEDGKTCRDGATEMLLLARRTDLRRISLDMPDFTDIILQVDN
IRHAIAIDYDPVEGYVYWTDDDVKAIRRSLLDGSDAQFVVTSQVDHPDGIAVDWIARNLY
WTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGDVPKIERADLDG
MERVVMVNTSLGWPNGLALDYEERKIYWGDAKTDKIEVMNMDGTGRRVLVEDKLPHIFGF
TLLGDYIYWTDWQRRSIECVHKRTAVREFIIDQLPDLMGLKATNVHEAFGTNPCADDNGG
CSHLCLYKPQGVQCGCPIGLELIADMKTCIVPEAFLLFSRHTDIRRISLETNSNNVAIPL
TGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAM
DGTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGLDREVIADDLPHPFGL
TQYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTNG
HCSHLCLAVPVSSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPDII
LPIHNLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSMTVVSGSLGGHSQGLQLYD
LSIDIYSRFIYWTSEVTNVINVTRIDGSRVGVVLREEHDKPRAIVVNPERGYMYFTNLME
RSAKIERAALDGTEREVLFFSGLMKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIV
IADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELD
MREYSKHPCTWENGGCSHICIVKGDGTTRCSCPVHLVLLPDELSCGEPPTCSPEQFSCTS
GEVDCIPQAWRCDGYAECDDGSDEEDCPVCSDSEFQCDSRQCIELSLRCNGEINCQDKSD
ENKCEVRCPADQFTCFNGQCIGKHKKCDHNMDCMDNSDETGCYPTEEPPPPPHNTIGSIV
AVVMALFVVGAIYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHPSSLSSSLPG
MSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQY
TVEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPLKSSATAKGY
TSDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_004564919.1.88231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]