SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004581932.1.84141 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004581932.1.84141
Domain Number 1 Region: 77-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.79e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004581932.1.84141
Sequence length 135
Comment PREDICTED: helix-loop-helix protein 2 [Ochotona princeps]; AA=GCF_000292845.1; RF=representative genome; TAX=9978; STAX=9978; NAME=Ochotona princeps; AL=Scaffold; RT=Major
Sequence
MMLSPDQAADSDHPSSAHSDPESLGGADAKVLGSVSDLEPVEEAEGEGKGGSRAALYPHP
QQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILR
LAICYISYLNHVLDV
Download sequence
Identical sequences XP_004581932.1.84141 ENSOPRP00000006095 ENSOPRP00000006095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]