SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004584458.1.84141 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004584458.1.84141
Domain Number 1 Region: 28-516
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-142
Family ALDH-like 0.000000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004584458.1.84141
Sequence length 533
Comment PREDICTED: methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial isoform X1 [Ochotona princeps]; AA=GCF_000292845.1; RF=representative genome; TAX=9978; STAX=9978; NAME=Ochotona princeps; AL=Scaffold; RT=Major
Sequence
MAAVVAAAAVRARILQVSSKVNYSWHPASSFSSSVPTVKLFIDGKFIESKSDKWIDIHNP
ATNEVIGRVPHSTKAEMDAAVASCKRAFPAWADTSILSRQQVLLRYQQLIKENLKEIAKL
ITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMPSITKDMDLYSYRLPLGVCAGI
APFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQH
EAVNFICDNPDIKAISFVGSNQAGEYIFERGSRNGKRVQANMGAKNHGVVMPDANKENTL
NQLVGAAFGAAGQRCMALSTAILVGEARKWLPELVERAKNLRVNAGDQPGADLGPLITPQ
AKERVCNLIESGPKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPV
LVVLETETLDEAIKIVNDNPYGNGTAIFTTNGATARKYSHLVDVGQVGVNVPIPVPLPMF
SFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSTPAVVMPTMGR
Download sequence
Identical sequences ENSOPRP00000004235 XP_004584458.1.84141 ENSOPRP00000004235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]