SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004585760.1.84141 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004585760.1.84141
Domain Number 1 Region: 64-107
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000458
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004585760.1.84141
Sequence length 151
Comment PREDICTED: DNA-binding protein inhibitor ID-1 [Ochotona princeps]; AA=GCF_000292845.1; RF=representative genome; TAX=9978; STAX=9978; NAME=Ochotona princeps; AL=Scaffold; RT=Major
Sequence
MKVASGSAVATAGPSCALKAGKTAGGAGEVVRCLSEQSVAISRCAGTRLPALLDEQQVNV
LLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSEAEVGTPGGRGLP
GRAPLSTLNGEISSLTAEAACVPADDRILCR
Download sequence
Identical sequences ENSOPRP00000004267 ENSOPRP00000008147 ENSOPRP00000004267 ENSOPRP00000008147 XP_004585760.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]