SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004598316.1.84141 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004598316.1.84141
Domain Number 1 Region: 630-885
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-55
Family YWTD domain 0.00000539
Further Details:      
 
Domain Number 2 Region: 18-278
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-54
Family YWTD domain 0.00000166
Further Details:      
 
Domain Number 3 Region: 329-559
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-51
Family YWTD domain 0.00000299
Further Details:      
 
Domain Number 4 Region: 932-1187
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-38
Family YWTD domain 0.0000725
Further Details:      
 
Domain Number 5 Region: 1318-1356
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1280-1316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1240-1278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 888-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000115
Family EGF-type module 0.017
Further Details:      
 
Domain Number 9 Region: 585-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000931
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 284-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1198-1249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004598316.1.84141
Sequence length 1598
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Ochotona princeps]; AA=GCF_000292845.1; RF=representative genome; TAX=9978; STAX=9978; NAME=Ochotona princeps; AL=Scaffold; RT=Major
Sequence
MVSCACVLRGPAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKG
AVYWTDVSEEAIKQTYLNQTGVAVQSVVISGLVAPDGLACDWVGKKLYWTDSETNRIEVA
NLNGSSRRVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKVIVDSDIY
WPNGLTIDLDEQKLYWADAKLSFIHRANLDGSLRQKVVEGSLTHPFALTLSGDTLYWTDW
QTRSIHACNKRTGGKRKEILSSLYSPMDIQVLSQERQPSLHTRCEEDNGGCSHLCLLSPR
EPFYACACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHA
IAIDYDPLEGYVYWTDDEVHAIRRAYLDGSGAQTLVSTEINDPDGIAVDWVARNLYWTDT
GTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECANLDGQERH
VLVNTSLGWPNGLALDPQEGKLYWGDAKTDRIEVIGVDGTKRRTLLEDKLPHIFGFTLLG
DFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHL
CFFTPRATKCGCPIGLELLSDLQTCIVPEAFLLFTSRAAIHRISLETHTNDVAIPLTGVK
EASALDFDVCSHRIYWTDVSLKTISRAFMNGSSVEQVIDFGLDYPEGMAVDWMGRNLYWA
DTGTNRIEVARLDGQFRRVLVWRDLDNPRSLALDPAKGYLYWTEWGGRPRIVRAFMDGTN
CVTLVDKVGRANDLTIDYADQRLYWADLDTNMIESSDMLGQERAVIADDLPHPFGLTQYS
DYIYWTDWNLHSIERADKTSGRNRTLVQGHLDFVMDILVFHASRQGGLNDCTYSNGQCGQ
LCLAVPAGHRCSCASHYTLDPDTRNCSPPTTFLLFSQKYAISRMIPDDQRSPDLVLPLHG
LRNVRAISYDPLDRFIYWVDGRQNIKRAKDDGTQPFVLTSQSQNPDRQPHDLSVDIYGRA
LFWTCEATNTINVQRLNGEAMGVVLRGDRDRPRAIVVNAERGYLYFTNMQERTAKIERAA
LDGTEREVLFTTGLVRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQP
AGLTVLGQHLYWVDRQQQMIERVEKTTGAKRTRVQGRVAHLTGIHAVEEVSPEEFLAHPC
ARDNGGCSHICVAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGA
WRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAVCL
PNQFRCASGQCVLIRQQCDSFPDCMDGSDELMCEITRPPSDDVVAHSSAIGPVIGIILSL
FVMGGVYFVCQRVVCQRYAGASGPFPHEYVSGTPHVPLNFIAPGGSQHGPFAGISCSKSM
MNSMNLVGSRAGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDVFC
SANIPPAATPYRPYVIRGTVPPTTPCSTDVCDSDYSASRWKSSKYYLDLNSDSDPYPPPP
TPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences XP_004598316.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]