SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004626126.1.9945 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004626126.1.9945
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 180-424
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-50
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-39
Family YWTD domain 0.000042
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-28
Family YWTD domain 0.0000444
Further Details:      
 
Domain Number 5 Region: 738-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000614
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1174-1210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1096-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1136-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000694
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004626126.1.9945
Sequence length 1465
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X3 [Octodon degus]; AA=GCF_000260255.1; RF=representative genome; TAX=10160; STAX=10160; NAME=Octodon degus; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSSRFVIINTEIYWPNGLTLDYEERKLYWADAKLNFIHKSNL
DGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACSKYTGEGLREIHSNIFSPMDI
HAFSQQRQPNATNPCGLDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKNGATELL
LLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKT
DKIEVMNTDGTERRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREIIIDQ
LPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSA
PTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRK
AQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVV
LKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPVALALDS
RLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCP
MHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSES
QFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDC
SDKSDELDCWISKGQGDDSPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDG
EAMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVT
GASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYRPYSYRHFAPP
TTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCP
PSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_004626126.1.9945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]