SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004656836.1.11716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004656836.1.11716
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-56
Family YWTD domain 0.0000059
Further Details:      
 
Domain Number 2 Region: 180-427
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-36
Family YWTD domain 0.0000879
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-28
Family YWTD domain 0.0000829
Further Details:      
 
Domain Number 5 Region: 1173-1208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 1135-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1095-1133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000194
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family EGF-type module 0.021
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1053-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000147
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004656836.1.11716
Sequence length 1453
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Jaculus jaculus]; AA=GCF_000280705.1; RF=representative genome; TAX=51337; STAX=51337; NAME=Jaculus jaculus; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSSRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHCANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKREEILGALYSPMDI
QVLSQERQPPLHTPCEEDNGGCSHLCLLSPREPFYACACPTGVQLQDNGKTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVEGIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTNRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECANLDGRERRILVNTSLGWPNGLALDMQEGKLYWGDAKT
DKIEVINVDGTKRQTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKAVRDVIIDQ
LPDLMGLKAVNVAKVIGTNPCADRNGGCSHLCFFTPHATKCGCPMGLELLSDMKTCIVPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQG
HLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAVPGGHRCGCASHYTLDPSSRNCSPP
STFLLFSQKCAISRMIPDDQHSPDLILPLHGLRNVKAINYDPLDKFIYWVDGRQNIKRAK
DDGTQAGPSVLTSSGQSLSPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVL
RGDRDKPRAIAVNAERGYMYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNT
LGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPMGLTVLGRHLYWIDRQQQMIERVEK
TTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSSHPCARDNGGCSHICIAKGDGTPRCSCPI
HLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSASQ
FLCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCA
DGSDELMCGEPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVMCQRYSGASGPFPH
EYVSGTPHVPLNFMAPGSTQHGPFPGISCSKSMMSSVSLVGGRGGMPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPAAARPYSHRPYIIRGVAPPTTP
CSTDVCDSDYSTSRWKTSKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYCH
LFPPPPSPCTDSS
Download sequence
Identical sequences XP_004656836.1.11716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]