SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004698710.1.18182 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004698710.1.18182
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 2173-2292
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-34
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-34
Family Spectrin repeat 0.0000798
Further Details:      
 
Domain Number 4 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-29
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 4.8e-29
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.61e-28
Family Spectrin repeat 0.00000454
Further Details:      
 
Domain Number 7 Region: 1532-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 8 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 9 Region: 1222-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-24
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 10 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 3.88e-23
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 12 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.34e-18
Family Spectrin repeat 0.00066
Further Details:      
 
Domain Number 13 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-17
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000216
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 15 Region: 1386-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000183
Family Spectrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004698710.1.18182
Sequence length 2329
Comment PREDICTED: spectrin beta chain, erythrocytic [Echinops telfairi]; AA=GCF_000313985.1; RF=representative genome; TAX=9371; STAX=9371; NAME=Echinops telfairi; AL=Scaffold; RT=Major
Sequence
MTSATEFANEGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
ERMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRT
LEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLRARRQRLEMTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLQFTEGQGY
QPCDPQVIQDRVSHLEQCFGELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAEGMVARKQFGHPQIEARVRE
VSAQWDQLKELAAFRKKNLQDAETFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGSTRA
LGKKHKDFLEELEESRAVREHLEQQAQGFPQEFRDSPDVTNRLQALRELDHQVVAQADLR
RQRLQDALDLYTVFGETDACELWMGEKEKWLARMEIPDTLEDLEVVQHRFDILDQEMKTL
LAQIDGVNLAANSLVESGHPRSAEVKQCQDHLNTRWQAFNTMVLERREAVDSALRVHNYC
VDCEETSKWIVDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQSRVGALERESQR
LMESHPELKEDIGRRQAYVEELWQGLQRALQGQEASLGEASQLQAFLQDLDDFQAWLSLA
QKAVASEDTPESLPEAEQLLQQHEAIKEEIDGHQESYQQVRASGEKVTHGQTDPEYLLLG
QRLEGLEVGWDALCRMWESRGRSLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLGSMENNRDRVSSPVNSGNKLVAEGNLYTDKIKEKVQLIEDRHRKNE
EKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLASQDVSYDEARNLHNKWLKHQAFVA
ELASHQGWLENVDAEGKQLMEEKPQFSATVSQRLEALHRLWDELQATTQEKAHQLSAARS
SDLRAQTHADLNKWISAMEDQLRSDDLGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFA
QVPSLGAEAGDTDVSIEKRFLDLLEPLGRRKKQLEASKAKLQISRDLEDETLWVEERLPL
AQSADYGINLQTVQLFMKKNQTLQNEILGHAPRIETVLQRGHQLVEAAEVDWRDIEERLG
HLQSSWDTLREAAAGRLQRLRDANEAQQYYLDAGEAEAWISEQELYVISDETPKDEEGAI
VMLKRHLRQQRTVEEYGRNIQQLASRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDVAE
ERKRKLENMYHLFQLKREADDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNAVIEQLIDMGHGEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKADAIQNKEQEVSTAWQALLDACAGRRTQLVDTADKFRFFSMVRDLLSWME
SIIRQIETQERPRDVSSVELLMKYHQGIQAEIETRSKNFSACLELGESLLQRQHQASDQI
QEKLRQVVSRRKEMNEKWDARWERLCLLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIKRHEAFEKSTTSWAERFAALEKPTTLELKERQTPERLAEETGAQEEEGETAG
EAPRAPDRAATERTSPGEDARPGTQGLQPPPPRGLPGCQEEKPGEERPPTEPHFKVLDTP
LSEGDEPTTLPGQRDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFYK
DAKNLALGVPYHGEEPLALRHAICEVAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLSW
LQGVSTAINESQSIRIKAQSLPLPSIAGTDATLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_004698710.1.18182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]