SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004709520.1.18182 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004709520.1.18182
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.88e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000808
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 7.85e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004709520.1.18182
Sequence length 109
Comment PREDICTED: transcription initiation factor IIA subunit 2 [Echinops telfairi]; AA=GCF_000313985.1; RF=representative genome; TAX=9371; STAX=9371; NAME=Echinops telfairi; AL=Scaffold; RT=Major
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSSTTE
Download sequence
Identical sequences H0WVI0 K9IG60
ENSOGAP00000006320 ENSOGAP00000006320 XP_003418382.1.64505 XP_003784440.1.62490 XP_004709520.1.18182 XP_010596316.1.64505 XP_010596317.1.64505 XP_010596318.1.64505 XP_010596319.1.64505 XP_010596320.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]