SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004716267.1.18182 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004716267.1.18182
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-57
Family YWTD domain 0.00000312
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-55
Family YWTD domain 0.0000014
Further Details:      
 
Domain Number 3 Region: 331-570
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-50
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 4 Region: 935-1195
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-39
Family YWTD domain 0.0000364
Further Details:      
 
Domain Number 5 Region: 889-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000108
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000535
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000115
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1247-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1288-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000152
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1205-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000542
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004716267.1.18182
Sequence length 1614
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Echinops telfairi]; AA=GCF_000313985.1; RF=representative genome; TAX=9371; STAX=9371; NAME=Echinops telfairi; AL=Scaffold; RT=Major
Sequence
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGRDNATIVVGGLEDAAAVDFVF
GHGWLYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGIACDWLGEKLYWTDSESNRIE
VSNLDGSLRKVLYWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSTRFVIINTN
IYWPNGLTVDYEEQKLYWADAKLNFIHKANVDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGESLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCRNGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRTFLDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPVIGYMYWTDWGEIPKIERAAMDGSD
RVVLVNTSLGWPNGLALDYDEHKIYWGDAKTDKIEVINTDGSGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRASMDG
SERTTLVPNVGRANGLTIDYTKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNTDNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEILQPYDL
SIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGDQDRPRAIVVNPEKGYMYFTNLQER
SPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVV
EDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNL
QEFRQHPCTQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTG
EIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIEGALRCNGDANCQDKSDE
KNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCGDKSDELDCYPTEEPAPQPTNTVGSVIG
VIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSASLPGM
SRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYT
MEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSD
LNYDSEPVPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_004716267.1.18182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]