SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004740049.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004740049.1.14098
Domain Number 1 Region: 17-178
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.75e-35
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004740049.1.14098
Sequence length 184
Comment PREDICTED: lactoylglutathione lyase [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAEPQPASSGLTDEAALGCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRILGMTLLQK
LDFPTMKFSLYFLAYEEKNDIPKDKDEKIAWVFSRKATLELTHNWGTEDDETQSYHSGNS
DPRGFGHIGIAVPDVHGACKRFEELGVKFVKRPDDGKMKGLAFIQDPDGYWIEILNPNKM
TTII
Download sequence
Identical sequences M3YR22
ENSMPUP00000013781 ENSMPUP00000013781 XP_004740049.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]