SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004740932.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004740932.1.14098
Domain Number 1 Region: 289-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-54
Family SPRY domain 0.0000352
Further Details:      
 
Domain Number 2 Region: 4-77
Classification Level Classification E-value
Superfamily RING/U-box 8.84e-19
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 88-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000916
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004740932.1.14098
Sequence length 475
Comment PREDICTED: E3 ubiquitin-protein ligase TRIM62 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP
ALAPSLKLANIVERYSAFPLDAILNARRAARPCQAHDKVKLFCLTDRALLCFFCDEPALH
EQHQVTGIDDAFEELQRELKEQLQALQDSEREHTEALQLLKRQLAETKSSTKSLRTTIGE
AFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAETD
RHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALTLD
PGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGVHYWEVVVAEK
TQWVIGLAHEAASRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFL
DYDQGLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVRI
Download sequence
Identical sequences A0A0D9S7V4 A0A2K5CFZ3 A0A2K5JWS7 A0A2K5NUI7 A0A2K5UPW1 A0A2K6E1U8 A0A2K6V1B5 D2HI43 F1SV81 F6WUS0 I3N4K2 K7ZRL3 M3YUH0 U3EY08
ENSSSCP00000003925 ENSAMEP00000007694 ENSSTOP00000019298 ENSMPUP00000014980 ENSSTOP00000019298 9544.ENSMMUP00000019781 9823.ENSSSCP00000003925 ENSSSCP00000003925 ENSMPUP00000014980 NP_001244681.1.72884 NP_001277176.1.62641 XP_002921898.1.58354 XP_003127811.1.46622 XP_004406499.1.74151 XP_004740931.1.14098 XP_004740932.1.14098 XP_005317834.1.77405 XP_005353268.1.66349 XP_005395165.1.28644 XP_006995763.1.50099 XP_010346417.1.74449 XP_011282940.1.62641 XP_011761616.1.29376 XP_011810774.1.43180 XP_011935010.1.92194 XP_011935011.1.92194 XP_011935012.1.92194 XP_012295842.1.9421 XP_019285447.1.44245 XP_019285448.1.44245 XP_021492928.1.76796 XP_021539347.1.83697 ENSMMUP00000019781 ENSMMUP00000019781 ENSAMEP00000007694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]