SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004742791.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004742791.1.14098
Domain Number 1 Region: 391-595
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004742791.1.14098
Sequence length 747
Comment PREDICTED: rho GTPase-activating protein 28 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MLVSAFVLGPERGHAPLRMEVEDSGGVVLTAYHSYARSQPPSSEPRCAPRATASHPGSRK
SIPRCRRINRMLSNESLHSPAFSRSNSQASIDSTSMEEFLREIESIKENSMGGQEEQLPA
EVKPVDEGELEAEWLQDVGLSTLISGNEEEDGKALLSTLTRTQAAAVKKRYNTYTQTMRK
KNKQSVRDVRDIFGVSESPPGDTCDNHTAQLDGTLEEKELPGIIKTSGSLPDGASLNNTT
LSDGSQDEEGGFAVPRSGSVSVLEPLPALPVLSNGSPDPAQAVQNAGSDDDYRKKNIPPE
TEELSFEVSYSEMVTEAPKRSKFKKSDFKKEDYALTKFIVQKTRFGLTEAGDLSAEDMKK
VRHLSLIELTAFFDAFGIQLKRNKTERVKGRDNGIFGVPLTVLLDNDRKKDPGVKVPLVL
QKFFEKVEESGLESEGIFRLSGCTAKVKQYREELDAKFNADKFKWDRMCHREAAVMLKAF
FRELPTSLFPVEYIPAFITLIERGPHIKVQFQALHLMIMALPDANRDTAQALMTFFNKVI
ANESKNRMSIWNISTIMAPNLFFSRSKHSDYEELQLANTAAHIIRLMLKYQKILWKVPSF
LITQVRRMNEATMLLKKQLPSVKKLLRRKTIEREVISPKTSKVLQKSPSSRRMSDVPEGV
IRVHAPLLSKVSMAIQLTSHTKAKDILAKFQYENSHGSSECFKIQNQRLYEIGGNIGQHC
LDPDAYILDIYHVNPQAEWVIKPQPSF
Download sequence
Identical sequences M3Y0M6
ENSMPUP00000004877 ENSMPUP00000004877 XP_004742791.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]