SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004747071.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004747071.1.14098
Domain Number 1 Region: 237-355
Classification Level Classification E-value
Superfamily ApaG-like 1.44e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 76-143,170-200
Classification Level Classification E-value
Superfamily YccV-like 0.00000000000981
Family YccV-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004747071.1.14098
Sequence length 368
Comment PREDICTED: polymerase delta-interacting protein 2 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAGCVARRALAVGSRWWSRSLTGARGPRPLCSAGGAGAFPPAATTTTRRHLSSRNRPEGK
VLETVGVFEVPKQNGKYETGQLFLHSVFGYRGVVLFPWQARLYDRDVASTAPEKAENPAG
HGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHED
ILPYTSTDQVPIQHELFERFLLYDQTKSPPFVARETLRAWQEKNHPWLELSDVHRETTEN
IRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRG
VVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEK
TPPSGLHW
Download sequence
Identical sequences M3YSA7
XP_004747071.1.14098 ENSMPUP00000014217 ENSMPUP00000014217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]