SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004748307.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004748307.1.14098
Domain Number 1 Region: 123-228
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000722
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 2 Region: 320-499
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000217
Family Fibronectin type III 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004748307.1.14098
Sequence length 654
Comment PREDICTED: interleukin-27 receptor subunit alpha isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MRGPRAPLFGPWPKLVLLPLLLLLGHRTRSRDSPGPLQCYGVGPLGDLNCSWEALGDLGA
PSTLHLQSQKYHSKRTWTVPVPAGQSWVTIPREQLTMSDELLVWGTKAGQPLWPPVFVNL
ETRMKPDAPRLYPDVDFSEDEPLEATVHWAPPVWPPHNVMACQFYYQRCQGTAWTLLEPE
LKSIPLAPVEIQDLELATGYEVRGRCRMEKEENLWSEWSPTLFFQTLPSAPKDVWISGNL
CGTPGRQEPLLLWKNPGHCVQMSYKVWFQAEGQELIQKTAPCCSSSVPALAEWVGVSAIN
ATSWEPLTNLSLACLGPDLAPRDVVVSSIAGSTGLLVTWQRGSGELQEHVVDWVQDGDRL
EHLRWIRLPPENLSALLPGNFERGVPYRITVTAVSPWGVAPAPSVWRFREELVPLAGPVL
WRLQDAPPGTPVIAWGEVPRHQLRGHLTHYTVYVQSGTKPTVCMNVSRSTRNITLPDLPW
GPCELWVTASTNAGQGPPGLSLRLHLPDNSLKWKVLPGVFLLWGLLLTGCGVSLATSRRC
LHLRHKVLPRWVWEKIPDPANSNCGQPHVEEVPQAQPPRDLPILKVEEMEPLPVMEHPQT
STQLGSGYEKHFLPTPEELGLLGPPPVPKFRPEPSPGQERGAHLTDEDTEAQRG
Download sequence
Identical sequences M3XVI8
ENSMPUP00000003088 XP_004748307.1.14098 ENSMPUP00000003088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]