SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004751467.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004751467.1.14098
Domain Number 1 Region: 12-112
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-27
Family SH2 domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004751467.1.14098
Sequence length 143
Comment PREDICTED: SH2 domain-containing protein 1B [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDYRAPSRLAVDLPYYHGPLSKKDCETLLLQDRVDGNFLIRDSESVPGVLCLCVSFKNFV
YTYRIFKDGRGFYNIQTVEGAPQMLFSNLKELISTFEKPNQGLVVQLRHPIKQASSRPRW
RRSQIQLDSIYENSNSDYVEVLP
Download sequence
Identical sequences M3XWX6
ENSMPUP00000003576 ENSMPUP00000003576 XP_004751467.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]