SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004756518.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004756518.1.14098
Domain Number 1 Region: 24-185,223-348
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-62
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 494-679
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000964
Further Details:      
 
Domain Number 3 Region: 731-786
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004756518.1.14098
Sequence length 1071
Comment PREDICTED: SLIT-ROBO Rho GTPase-activating protein 2 isoform X3 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIE
MDYSRNLEKLAERFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY
LNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSK
LKEAEKQEEKQFGKSVKQEDRQTPRSPDSSSNVRIEEKHVRRSSVKKIEKMKEKRQAKYT
ENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAEL
NLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQ
PVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSME
SVKSTVSETFMSKPSIAKRRANQQETEQFYFTKMKEYLEGRNLITKLQAKHDLLQKTLGE
SQRTDCSLARRSSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKN
AFERGEDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQERALH
IRKVLLVLPKTTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSC
QAHVNELIKTTIIQHENIFPTPRELEGPVYSRGGSTEDYCDSPHGETTSAEDSTQDVTTE
HHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRHNGMDGLIPHQ
YIVVQDTEDGVVERSSPKSDIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKR
PESGSIRKTFRSDSHGLSGSLTDSATPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGS
LNSISRHSSLKNRLDSPQIRKTVTAGRSKSFNNHRPVDPEVIAQDIEATMNSALNELREL
ERQSSVKHTPDVVLDTLEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIAC
AFRPVKSVKMAAPVKPPATRPKPTVFPKTNATSPGVNSSSSPQSTDKSCTV
Download sequence
Identical sequences M3YKW7
ENSMPUP00000011974 XP_004756518.1.14098 ENSMPUP00000011974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]