SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004759587.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004759587.1.14098
Domain Number 1 Region: 7-94,132-158
Classification Level Classification E-value
Superfamily FKBP-like 2.55e-19
Family FKBP immunophilin/proline isomerase 0.0017
Further Details:      
 
Domain Number 2 Region: 174-318
Classification Level Classification E-value
Superfamily TPR-like 9.79e-19
Family Tetratricopeptide repeat (TPR) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004759587.1.14098
Sequence length 330
Comment PREDICTED: AH receptor-interacting protein isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDKEGTVLDDSRVRGKPM
ELIIGKKFKLPVWETIVCTMREGEIAQFCCDVKHVVLYPLVAKSLRNIAAGKDPLEGQRH
CCGIAQMHEHNSLGHADLDALQQNPQPLIFDIEMLKVESPGTYQQDPWAMTDEEKAKAVP
LIHQEGNKLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPDWIQLDQQITPLLLNYCQC
KLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAP
IVGRELRALEARIRQKDEEDKARFRGIFSH
Download sequence
Identical sequences M3XXW8
ENSMPUP00000003919 XP_004759587.1.14098 ENSMPUP00000003919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]